genotypst is a bioinformatics package for Typst that enables analysis and visualization of biological data. It provides functionality for parsing FASTA and Newick files and generating publication-ready visualizations, including multiple sequence alignments, sequence logos, genome maps, and phylogenetic trees.
Documentation
Refer to the manual for a comprehensive guide containing examples illustrating how to use genotypst.
Quickstart
A minimal example illustrating the use of genotypst is shown below. To reproduce it, download the example multiple sequence alignment file msa.afa.
In a Typst document, import the genotypst package:
#import "@preview/genotypst:0.10.0": *
You can perform a simple pairwise alignments and visualize both the alignment and its dynamic programming matrix:
// Perform a local alignment of two DNA sequences
#let dna_alignment = align-seq-pair(
"AAT",
"AACTTG",
match-score: 3,
mismatch-score: -1,
gap-penalty: -1,
mode: "local",
)
// Render the alignment
#render-pair-alignment(
dna_alignment.seq-1,
dna_alignment.seq-2,
dna_alignment.traceback-paths.at(0),
)
// Render the dynamic programming matrix
#render-dp-matrix(
dna_alignment.seq-1,
dna_alignment.seq-2,
cell-values: dna_alignment.dp-matrix.scores,
path: dna_alignment.traceback-paths.at(0),
arrows: dna_alignment.dp-matrix.arrows,
)
Read a FASTA file containing a multiple sequence alignment:
// Load sequences
#let sequences = parse-fasta(read("msa.afa"))
// Display the `sequences` variable
#repr(sequences)
(
"gi|503891280": "MIQRSLRDKQIIKVLTGVRRCGKSTILQMFINFEDLAYEKYDYYELYQYL…",
"gi|502172365": "TRPRVLRRVMGAVLIDGPKAVGKTQTTTRVLRLDVDVARAALVPEQLFE-…",
"gi|504805136": "IYPRMDILPNFALVVSGIRRSGKSTLLTQFLNFDTPQLFNFEDFALLDEI…",
"gi|502700462": "----MLETDLPALLIVGPRASGKTTTAARTVRLDVPAQAAAFDPDAALRN…",
…
)
A region of the multiple sequence alignment can be rendered with render-msa:
// Render a multiple sequence alignment between positions 100 and 135
#context {
set text(size: 0.85em)
render-msa(protein_msa, start: 100, end: 135, colors: true, conservation: true)
}
The same region of the alignment can also be visualized as a sequence logo using render-sequence-logo:
// Render a sequence logo between positions 100 and 135
#render-sequence-logo(sequences, start: 100, end: 135)
To render a genomic locus, you can pass an array of genomic features to the render-genome-map function:
// Render a genome map containing five features
#let locus = (
(start: 400, end: 1260, strand: 1, label: [A], color: rgb("#56B4E9")),
(start: 1300, end: 2200, strand: 1, label: [B]),
(start: 2250, end: 3460, strand: -1, label: [C], color: rgb("#E69F00")),
(start: 3500, end: 3800, label: [D]),
(start: 3850, end: 5400, strand: 1, label: [E]),
)
#render-genome-map(
locus,
coordinate-axis: true,
width: 80%,
)
You may also read genomic features from GFF3 files using the parse-gff function.
You can also use genotypst to parse Newick data and visualize phylogenetic trees:
// Parse Newick data
#let tree = parse-newick(
"(('Leaf A':0.2,'Leaf B':0.1)'Internal node':0.3,'Leaf C':0.6)Root;"
)
// Render the phylogenetic tree
#render-rectangular-tree(tree)